NUDT17 Antikörper

Produktnummer ABIN630706

Produktdetails anti-NUDT17 Antikörper

Target: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDT17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDT17

Target: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Andere Bezeichnung: NUDT17 (NUDT17 Produkte)

Synonyme: 2410015C20Rik antikoerper, RGD1565469 antikoerper, zgc:114128 antikoerper, nudix hydrolase 17 antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 17 antikoerper, NUDT17 antikoerper, Nudt17 antikoerper, nudt17 antikoerper

Hintergrund: NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Molekulargewicht: 36 kDa (MW of target protein)