NUDT17 Antikörper
-
- Target Alle NUDT17 Antikörper anzeigen
- NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUDT17 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD
- Top Product
- Discover our top product NUDT17 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))
- Andere Bezeichnung
- NUDT17 (NUDT17 Produkte)
- Synonyme
- 2410015C20Rik antikoerper, RGD1565469 antikoerper, zgc:114128 antikoerper, nudix hydrolase 17 antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 17 antikoerper, NUDT17 antikoerper, Nudt17 antikoerper, nudt17 antikoerper
- Hintergrund
- NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
- Molekulargewicht
- 36 kDa (MW of target protein)
-