TTC5 Antikörper (C-Term)

Produktnummer ABIN630694

Produktdetails anti-TTC5 Antikörper

Target: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC5 antibody was raised against the C terminal of TTC5

Aufreinigung: Affinity purified

Immunogen: TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC5

Target: TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))

Andere Bezeichnung: TTC5 (TTC5 Produkte)

Synonyme: TTC5 antikoerper, ttc5 antikoerper, wu:fi33h05 antikoerper, wu:fy81e07 antikoerper, zgc:112059 antikoerper, Strap antikoerper, 5930437N14 antikoerper, AW743060 antikoerper, tetratricopeptide repeat domain 5 L homeolog antikoerper, tetratricopeptide repeat domain 5 antikoerper, ttc5.L antikoerper, TTC5 antikoerper, ttc5 antikoerper, Ttc5 antikoerper

Hintergrund: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Chromatin Binding