RSF1 Antikörper (Middle Region)
-
- Target Alle RSF1 Antikörper anzeigen
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RSF1 antibody was raised against the middle region of RSF1
- Aufreinigung
- Affinity purified
- Immunogen
- RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
- Top Product
- Discover our top product RSF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
- Andere Bezeichnung
- RSF1 (RSF1 Produkte)
- Synonyme
- Rsf-1 antikoerper, CG5655 antikoerper, Dmel\\CG5655 antikoerper, ROX21 antikoerper, RSF1 antikoerper, Rox21 antikoerper, rox21 antikoerper, hbxap antikoerper, HBXAP antikoerper, RSF-1 antikoerper, XAP8 antikoerper, p325 antikoerper, 4832420A03Rik antikoerper, C030033M12Rik antikoerper, Gm164 antikoerper, Hbxap antikoerper, remodeling and spacing factor 1 antikoerper, Repressor splicing factor 1 antikoerper, remodeling and spacing factor 1 S homeolog antikoerper, RSF1 antikoerper, Rsf1 antikoerper, rsf1.S antikoerper
- Hintergrund
- RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.
- Molekulargewicht
- 164 kDa (MW of target protein)
-