RSF1 Antikörper (Middle Region)

Produktnummer ABIN630684

Produktdetails anti-RSF1 Antikörper

Target: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RSF1 antibody was raised against the middle region of RSF1

Aufreinigung: Affinity purified

Immunogen: RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSF1

Target: RSF1 (Remodeling and Spacing Factor 1 (RSF1))

Andere Bezeichnung: RSF1 (RSF1 Produkte)

Synonyme: Rsf-1 antikoerper, CG5655 antikoerper, Dmel\\CG5655 antikoerper, ROX21 antikoerper, RSF1 antikoerper, Rox21 antikoerper, rox21 antikoerper, hbxap antikoerper, HBXAP antikoerper, RSF-1 antikoerper, XAP8 antikoerper, p325 antikoerper, 4832420A03Rik antikoerper, C030033M12Rik antikoerper, Gm164 antikoerper, Hbxap antikoerper, remodeling and spacing factor 1 antikoerper, Repressor splicing factor 1 antikoerper, remodeling and spacing factor 1 S homeolog antikoerper, RSF1 antikoerper, Rsf1 antikoerper, rsf1.S antikoerper

Hintergrund: RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.

Molekulargewicht: 164 kDa (MW of target protein)