PDE7B Antikörper (Middle Region)

Produktnummer ABIN630666

Produktdetails anti-PDE7B Antikörper

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDE7 B antibody was raised against the middle region of PDE7

Aufreinigung: Affinity purified

Immunogen: PDE7 B antibody was raised using the middle region of PDE7 corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE7B Blocking Peptide, catalog no. 33R-3973, is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE7B

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Andere Bezeichnung: PDE7B (PDE7B Produkte)

Synonyme: PDE7B antikoerper, ba472e5.1 antikoerper, bA472E5.1 antikoerper, phosphodiesterase 7B antikoerper, PDE7B antikoerper, pde7b antikoerper, Pde7b antikoerper

Hintergrund: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process