KIF5A Antikörper (Middle Region)

Produktnummer ABIN630647

Produktdetails anti-KIF5A Antikörper

Target: KIF5A (Kinesin Family Member 5A (KIF5A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIF5 A antibody was raised against the middle region of KIF5

Aufreinigung: Affinity purified

Immunogen: KIF5 A antibody was raised using the middle region of KIF5 corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF5A Blocking Peptide, catalog no. 33R-4894, is also available for use as a blocking control in assays to test for specificity of this KIF5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF5A

Target: KIF5A (Kinesin Family Member 5A (KIF5A))

Andere Bezeichnung: KIF5A (KIF5A Produkte)

Synonyme: KIF5A antikoerper, kif5a antikoerper, si:ch211-166e11.4 antikoerper, wu:fj61a10 antikoerper, nkhc antikoerper, my050 antikoerper, spg10 antikoerper, d12s1889 antikoerper, MGC122802 antikoerper, D12S1889 antikoerper, MY050 antikoerper, NKHC antikoerper, SPG10 antikoerper, D10Bwg0738e antikoerper, Khc antikoerper, Kif5 antikoerper, Kns antikoerper, mKIAA4086 antikoerper, kinesin family member 5A antikoerper, kinesin family member 5A, a antikoerper, KIF5A antikoerper, kif5aa antikoerper, kif5a antikoerper, Kif5a antikoerper

Hintergrund: KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.

Molekulargewicht: 117 kDa (MW of target protein)