PRMT2 Antikörper (N-Term)
-
- Target Alle PRMT2 Antikörper anzeigen
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRMT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRMT2 antibody was raised against the N terminal of PRMT2
- Aufreinigung
- Affinity purified
- Immunogen
- PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
- Top Product
- Discover our top product PRMT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRMT2 Blocking Peptide, catalog no. 33R-2686, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
- Andere Bezeichnung
- PRMT2 (PRMT2 Produkte)
- Synonyme
- PRMT2 antikoerper, DKFZp459N1919 antikoerper, HRMT1L1 antikoerper, Hrmt1l1 antikoerper, AI504737 antikoerper, protein arginine methyltransferase 2 antikoerper, protein arginine methyltransferase 2 L homeolog antikoerper, protein arginine N-methyltransferase 2 antikoerper, PRMT2 antikoerper, Prmt2 antikoerper, prmt2.L antikoerper
- Hintergrund
- The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding
-