PDE9A Antikörper (N-Term)

Produktnummer ABIN630634

Produktdetails anti-PDE9A Antikörper

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE9A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PDE9 A antibody was raised against the N terminal of PDE9

Aufreinigung: Affinity purified

Immunogen: PDE9 A antibody was raised using the N terminal of PDE9 corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE9A Blocking Peptide, catalog no. 33R-8356, is also available for use as a blocking control in assays to test for specificity of this PDE9A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE9A

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Andere Bezeichnung: PDE9A (PDE9A Produkte)

Synonyme: PDE9A antikoerper, MGC116558 antikoerper, Pde9a antikoerper, HSPDE9A2 antikoerper, PDE9A1 antikoerper, phosphodiesterase 9A antikoerper, phosphodiesterase 9A S homeolog antikoerper, high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A antikoerper, PDE9A antikoerper, pde9a.S antikoerper, Pde9a antikoerper, LOC100549810 antikoerper, pde9a antikoerper

Hintergrund: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.

Molekulargewicht: 61 kDa (MW of target protein)