PDE9A Antikörper (N-Term)

Produktnummer ABIN630634

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PDE9A in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PDE9A Antikörper (N-Term) (ABIN630634)

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE9A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PDE9A Antikörper

Bindungsspezifität: N-Term

Spezifität: PDE9 A antibody was raised against the N terminal of PDE9

Aufreinigung: Affinity purified

Immunogen: PDE9 A antibody was raised using the N terminal of PDE9 corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE9A Blocking Peptide, (ABIN5615280), is also available for use as a blocking control in assays to test for specificity of this PDE9A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE9A

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Andere Bezeichnung: PDE9A

Hintergrund: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.

Molekulargewicht: 61 kDa (MW of target protein)