IMPDH1 Antikörper

Produktnummer ABIN630628

Produktdetails anti-IMPDH1 Antikörper

Target: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPDH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPDH1

Target: IMPDH1 (Inosine 5'-Phosphate Dehydrogenase 1 (IMPDH1))

Andere Bezeichnung: IMPDH1 (IMPDH1 Produkte)

Synonyme: IMPD antikoerper, IMPD1 antikoerper, LCA11 antikoerper, RP10 antikoerper, sWSS2608 antikoerper, B930086D20Rik antikoerper, IMPD 1 antikoerper, IMPDH 1 antikoerper, D3 antikoerper, IMPD 1b antikoerper, IMPDH 1b antikoerper, IMPDH1 antikoerper, id:ibd5035 antikoerper, si:dkey-31f5.7 antikoerper, wu:fa09h11 antikoerper, wu:fa99c03 antikoerper, zgc:113446 antikoerper, imp antikoerper, imp1 antikoerper, imp2 antikoerper, IMPD 1a antikoerper, IMPDH 1a antikoerper, zgc:91911 antikoerper, inosine monophosphate dehydrogenase 1 antikoerper, inosine-5'-monophosphate dehydrogenase 1 antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1b antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1 antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 1a antikoerper, IMPDH1 antikoerper, Impdh1 antikoerper, LOC100442769 antikoerper, impdh1 antikoerper, impdh1b antikoerper, impdh1.L antikoerper, impdh1a antikoerper

Hintergrund: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process