GNAL Antikörper
-
- Target Alle GNAL Antikörper anzeigen
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNAL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
- Top Product
- Discover our top product GNAL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNAL Blocking Peptide, catalog no. 33R-1134, is also available for use as a blocking control in assays to test for specificity of this GNAL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
- Andere Bezeichnung
- GNAL (GNAL Produkte)
- Synonyme
- DYT25 antikoerper, zgc:103521 antikoerper, 2610011C15Rik antikoerper, 9630020G10Rik antikoerper, AI843190 antikoerper, Galphaolf antikoerper, Gna10 antikoerper, Golf antikoerper, Olf antikoerper, RGD1305940 antikoerper, G protein subunit alpha L antikoerper, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type antikoerper, guanine nucleotide binding protein, alpha stimulating, olfactory type antikoerper, GNAL antikoerper, gnal antikoerper, Gnal antikoerper
- Hintergrund
- Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.
- Molekulargewicht
- 50 kDa (MW of target protein)
-