GNAL Antikörper

Produktnummer ABIN630618

Produktdetails anti-GNAL Antikörper

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAL Blocking Peptide, catalog no. 33R-1134, is also available for use as a blocking control in assays to test for specificity of this GNAL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAL

Target: GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))

Andere Bezeichnung: GNAL (GNAL Produkte)

Synonyme: DYT25 antikoerper, zgc:103521 antikoerper, 2610011C15Rik antikoerper, 9630020G10Rik antikoerper, AI843190 antikoerper, Galphaolf antikoerper, Gna10 antikoerper, Golf antikoerper, Olf antikoerper, RGD1305940 antikoerper, G protein subunit alpha L antikoerper, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type antikoerper, guanine nucleotide binding protein, alpha stimulating, olfactory type antikoerper, GNAL antikoerper, gnal antikoerper, Gnal antikoerper

Hintergrund: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Molekulargewicht: 50 kDa (MW of target protein)