Cnpase Antikörper (Middle Region)

Produktnummer ABIN630617

Produktdetails anti-Cnpase Antikörper

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cnpase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNP antibody was raised against the middle region of CNP

Aufreinigung: Affinity purified

Immunogen: CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNP Blocking Peptide, catalog no. 33R-5574, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Andere Bezeichnung: CNP (CNP Produkte)

Synonyme: CNP1 antikoerper, CNPase antikoerper, Cnp-1 antikoerper, Cnp1 antikoerper, CNPF antikoerper, CNPI antikoerper, CNPII antikoerper, CNP antikoerper, DKFZp469F1421 antikoerper, cnpl antikoerper, fd21d08 antikoerper, fi37a10 antikoerper, rich antikoerper, sb:cb662 antikoerper, si:ch73-158e11.4 antikoerper, wu:fd21d08 antikoerper, wu:fd44a05 antikoerper, wu:fi35d08 antikoerper, wu:fi37a10 antikoerper, cnp antikoerper, 2',3'-cyclic nucleotide 3' phosphodiesterase antikoerper, CNP antikoerper, Cnp antikoerper, cnp antikoerper, cnp.L antikoerper

Hintergrund: CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.

Molekulargewicht: 47 kDa (MW of target protein)