DPPA5 Antikörper (N-Term)

Produktnummer ABIN630614

Produktdetails anti-DPPA5 Antikörper

Target: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPPA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPPA5 antibody was raised against the N terminal of DPPA5

Aufreinigung: Affinity purified

Immunogen: DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPPA5 Blocking Peptide, catalog no. 33R-6080, is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPPA5

Target: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Andere Bezeichnung: DPPA5 (DPPA5 Produkte)

Synonyme: ESG1 antikoerper, developmental pluripotency associated 5 antikoerper, DPPA5 antikoerper, Dppa5 antikoerper

Hintergrund: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Molekulargewicht: 13 kDa (MW of target protein)