POLR1D Antikörper

Produktnummer ABIN630612

Produktdetails anti-POLR1D Antikörper

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR1D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLR1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR1D Blocking Peptide, catalog no. 33R-9258, is also available for use as a blocking control in assays to test for specificity of this POLR1D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR1D

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Andere Bezeichnung: POLR1D (POLR1D Produkte)

Synonyme: AC19 antikoerper, POLR1C antikoerper, RPA16 antikoerper, RPA9 antikoerper, RPAC2 antikoerper, RPC16 antikoerper, RPO1-3 antikoerper, TCS2 antikoerper, 1110003G10Rik antikoerper, Rpo1-3 antikoerper, im:7162148 antikoerper, zgc:136449 antikoerper, polr1d antikoerper, rpa16 antikoerper, rpa9 antikoerper, rpac2 antikoerper, rpo1-3 antikoerper, RNA polymerase I subunit D antikoerper, polymerase (RNA) I polypeptide D antikoerper, polymerase (RNA) I polypeptide D, 16kDa, gene 2 L homeolog antikoerper, POLR1D antikoerper, Polr1d antikoerper, polr1d antikoerper, polr1d.2.L antikoerper

Hintergrund: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

Molekulargewicht: 15 kDa (MW of target protein)