NASP Antikörper

Produktnummer ABIN630609

Produktdetails anti-NASP Antikörper

Target: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NASP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NASP

Target: NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))

Andere Bezeichnung: NASP (NASP Produkte)

Synonyme: FLB7527 antikoerper, PRO1999 antikoerper, 5033430J04Rik antikoerper, AI131596 antikoerper, AI317140 antikoerper, D4Ertd767e antikoerper, Epcs32 antikoerper, Nasp-T antikoerper, wu:fd20g12 antikoerper, zgc:56007 antikoerper, zgc:85651 antikoerper, nuclear autoantigenic sperm protein antikoerper, nuclear autoantigenic sperm protein (histone-binding) antikoerper, NASP antikoerper, Nasp antikoerper, nasp antikoerper

Hintergrund: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.

Molekulargewicht: 49 kDa (MW of target protein)