GTPBP10 Antikörper

Produktnummer ABIN630593

Produktdetails anti-GTPBP10 Antikörper

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTPBP10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTPBP10

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Andere Bezeichnung: GTPBP10 (GTPBP10 Produkte)

Synonyme: zgc:92334 antikoerper, ObgH2 antikoerper, 4930545J22Rik antikoerper, BC034507 antikoerper, Cldn12 antikoerper, GTP-binding protein 10 (putative) antikoerper, GTP binding protein 10 antikoerper, gtpbp10 antikoerper, GTPBP10 antikoerper, Gtpbp10 antikoerper

Hintergrund: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Molekulargewicht: 43 kDa (MW of target protein)