TNPO2 Antikörper
-
- Target Alle TNPO2 Antikörper anzeigen
- TNPO2 (Transportin 2 (TNPO2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNPO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA
- Top Product
- Discover our top product TNPO2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Transportin 2 Blocking Peptide, catalog no. 33R-5534, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNPO2 (Transportin 2 (TNPO2))
- Andere Bezeichnung
- Transportin 2 (TNPO2 Produkte)
- Synonyme
- TNPO2 antikoerper, IPO3 antikoerper, KPNB2B antikoerper, TRN2 antikoerper, ik:tdsubc_2a7 antikoerper, tdsubc_2a7 antikoerper, wu:fb01c02 antikoerper, wu:fe01f03 antikoerper, wu:fe16e12 antikoerper, xx:tdsubc_2a7 antikoerper, zgc:101009 antikoerper, 1110034O24Rik antikoerper, AA414969 antikoerper, AI464345 antikoerper, AI852433 antikoerper, Knpb2b antikoerper, Kpnb2b antikoerper, transportin 2 antikoerper, transportin 2 L homeolog antikoerper, transportin 2 (importin 3, karyopherin beta 2b) antikoerper, TNPO2 antikoerper, tnpo2.L antikoerper, Tnpo2 antikoerper, tnpo2 antikoerper
- Hintergrund
- Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
- Molekulargewicht
- 100 kDa (MW of target protein)
-