Cardiac Troponin T2 Antikörper

Produktnummer ABIN630581

Produktdetails anti-Cardiac Troponin T2 Antikörper

Target: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cardiac Troponin T2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Troponin T Type 2 Blocking Peptide, catalog no. 33R-2732, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cardiac Troponin T2

Target: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Abstract: cTnT Produkte

Synonyme: CMH2 antikoerper, CMPD2 antikoerper, LVNC6 antikoerper, RCM3 antikoerper, TnTC antikoerper, cTnT antikoerper, Tnt antikoerper, CTTG antikoerper, Ctt antikoerper, RATCTTG antikoerper, Tnnt3 antikoerper, tnnt2 antikoerper, CT3 antikoerper, si:ch211-136g2.1 antikoerper, troponin T2, cardiac type antikoerper, troponin T2, cardiac antikoerper, troponin T type 2a (cardiac) antikoerper, troponin T2, cardiac type L homeolog antikoerper, troponin T2e, cardiac antikoerper, TNNT2 antikoerper, Tnnt2 antikoerper, tnnt2a antikoerper, tnnt2.L antikoerper, tnnt2e antikoerper

Hintergrund: TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Molekulargewicht: 35 kDa (MW of target protein)