TRMT5 Antikörper

Produktnummer ABIN630573

Produktdetails anti-TRMT5 Antikörper

Target: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRMT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRMT5 Blocking Peptide, catalog no. 33R-2587, is also available for use as a blocking control in assays to test for specificity of this TRMT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRMT5

Target: TRMT5 (tRNA Methyltransferase 5 (TRMT5))

Andere Bezeichnung: TRMT5 (TRMT5 Produkte)

Synonyme: RGD1306567 antikoerper, 2610027O18Rik antikoerper, mKIAA1393 antikoerper, wu:fi28b08 antikoerper, KIAA1393 antikoerper, TRM5 antikoerper, tRNA methyltransferase 5 antikoerper, TRM5 tRNA methyltransferase 5 antikoerper, TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae) antikoerper, Trmt5 antikoerper, TRMT5 antikoerper, trmt5 antikoerper

Hintergrund: TRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.

Molekulargewicht: 58 kDa (MW of target protein)