FSTL5 Antikörper (Middle Region)

Produktnummer ABIN630564

Produktdetails anti-FSTL5 Antikörper

Target: FSTL5 (Follistatin-Like 5 (FSTL5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FSTL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FSTL5 antibody was raised against the middle region of FSTL5

Aufreinigung: Affinity purified

Immunogen: FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FSTL5 Blocking Peptide, catalog no. 33R-6862, is also available for use as a blocking control in assays to test for specificity of this FSTL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSTL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FSTL5

Target: FSTL5 (Follistatin-Like 5 (FSTL5))

Andere Bezeichnung: FSTL5 (FSTL5 Produkte)

Synonyme: Mahya antikoerper, FSTL5 antikoerper, drMahya-1 antikoerper, zgc:136225 antikoerper, 9130207J01Rik antikoerper, follistatin-like 5 antikoerper, follistatin like 5 antikoerper, follistati like 5 antikoerper, Fstl5 antikoerper, FSTL5 antikoerper, fstl5 antikoerper

Hintergrund: The function of Follistatin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 92 kDa (MW of target protein)