DCAF4 Antikörper (Middle Region)

Produktnummer ABIN630556

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DCAF4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für DCAF4 Antikörper (Middle Region) (ABIN630556)

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCAF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DCAF4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WDR21 A antibody was raised against the middle region of WDR21

Aufreinigung: Affinity purified

Immunogen: WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR21A Blocking Peptide, (ABIN938699), is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCAF4

Target: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Andere Bezeichnung: WDR21A

Hintergrund: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.

Molekulargewicht: 43 kDa (MW of target protein)