DCAF4 Antikörper (Middle Region)
-
- Target Alle DCAF4 Antikörper anzeigen
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCAF4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR21 A antibody was raised against the middle region of WDR21
- Aufreinigung
- Affinity purified
- Immunogen
- WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
- Top Product
- Discover our top product DCAF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR21A Blocking Peptide, catalog no. 33R-3313, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))
- Andere Bezeichnung
- WDR21A (DCAF4 Produkte)
- Synonyme
- Wdr21 antikoerper, 1110018E21Rik antikoerper, WDR21 antikoerper, WDR21A antikoerper, DDB1 and CUL4 associated factor 4 antikoerper, Dcaf4 antikoerper, DCAF4 antikoerper
- Hintergrund
- WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.
- Molekulargewicht
- 43 kDa (MW of target protein)
-