IFI35 Antikörper (N-Term)

Produktnummer ABIN630552

Produktdetails anti-IFI35 Antikörper

Target: IFI35 (Interferon-Induced Protein 35 (IFI35))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFI35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IFI35 antibody was raised against the N terminal of IFI35

Aufreinigung: Affinity purified

Immunogen: IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFI35 Blocking Peptide, catalog no. 33R-6397, is also available for use as a blocking control in assays to test for specificity of this IFI35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFI35

Target: IFI35 (Interferon-Induced Protein 35 (IFI35))

Andere Bezeichnung: IFI35 (IFI35 Produkte)

Synonyme: IFI35 antikoerper, IFP35 antikoerper, 2010008K16Rik antikoerper, AW986054 antikoerper, ifi-35 antikoerper, interferon induced protein 35 antikoerper, interferon-induced protein 35 antikoerper, IFI35 antikoerper, ifi35 antikoerper, Ifi35 antikoerper

Hintergrund: IFI35 has been shown to interact with NMI and BATF.

Molekulargewicht: 32 kDa (MW of target protein)