LCA5L Antikörper
-
- Target Alle LCA5L Produkte
- LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LCA5L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- C21 ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C21ORF13 Blocking Peptide, catalog no. 33R-3556, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))
- Andere Bezeichnung
- C21ORF13 (LCA5L Produkte)
- Synonyme
- C21orf13 antikoerper, 4921526F01Rik antikoerper, Lcca5l antikoerper, Leber congenital amaurosis 5-like antikoerper, LCA5L, lebercilin like antikoerper, LCA5L antikoerper, Lca5l antikoerper
- Hintergrund
- The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 76 kDa (MW of target protein)
-