ZNF33A Antikörper (Middle Region)

Produktnummer ABIN630524

Der Kaninchen Polyklonal anti-ZNF33A Antikörper wird verwendet zum Nachweis von ZNF33A in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ZNF33A Antikörper (Middle Region) (ABIN630524)

Target: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF33A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZNF33A Antikörper

Bindungsspezifität: Middle Region

Spezifität: ZNF33 A antibody was raised against the middle region of ZNF33

Aufreinigung: Affinity purified

Immunogen: ZNF33 A antibody was raised using the middle region of ZNF33 corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF33A Blocking Peptide, (ABIN5617164), is also available for use as a blocking control in assays to test for specificity of this ZNF33A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZNF33A

Target: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Andere Bezeichnung: ZNF33A

Hintergrund: ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.

Molekulargewicht: 80 kDa (MW of target protein)