ZNF33A Antikörper (Middle Region)
-
- Target Alle ZNF33A Antikörper anzeigen
- ZNF33A (Zinc Finger Protein 33A (ZNF33A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZNF33A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZNF33 A antibody was raised against the middle region of ZNF33
- Aufreinigung
- Affinity purified
- Immunogen
- ZNF33 A antibody was raised using the middle region of ZNF33 corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD
- Top Product
- Discover our top product ZNF33A Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZNF33A Blocking Peptide, catalog no. 33R-5320, is also available for use as a blocking control in assays to test for specificity of this ZNF33A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZNF33A (Zinc Finger Protein 33A (ZNF33A))
- Andere Bezeichnung
- ZNF33A (ZNF33A Produkte)
- Synonyme
- KOX2 antikoerper, KOX31 antikoerper, KOX5 antikoerper, NF11A antikoerper, ZNF11 antikoerper, ZNF11A antikoerper, ZNF33 antikoerper, ZZAPK antikoerper, zinc finger protein 33A antikoerper, ZNF33A antikoerper
- Hintergrund
- ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.
- Molekulargewicht
- 80 kDa (MW of target protein)
-