NR0B2 Antikörper (N-Term)

Produktnummer ABIN630500

Produktdetails anti-NR0B2 Antikörper

Target: NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR0B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR0 B2 antibody was raised against the N terminal of NR0 2

Aufreinigung: Affinity purified

Immunogen: NR0 B2 antibody was raised using the N terminal of NR0 2 corresponding to a region with amino acids STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR0B2 Blocking Peptide, catalog no. 33R-8889, is also available for use as a blocking control in assays to test for specificity of this NR0B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR0B2

Target: NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))

Andere Bezeichnung: NR0B2 (NR0B2 Produkte)

Synonyme: SHP antikoerper, SHP1 antikoerper, SHP-1 antikoerper, Shp1 antikoerper, Shp antikoerper, NR0B2-A antikoerper, Nr0b2 antikoerper, SHP-A antikoerper, gb:bc058069 antikoerper, nuclear receptor subfamily 0 group B member 2 antikoerper, nuclear receptor subfamily 0, group B, member 2 antikoerper, nuclear receptor subfamily 0, group B, member 2a antikoerper, NR0B2 antikoerper, Nr0b2 antikoerper, nr0b2a antikoerper

Hintergrund: NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway