RHAG Antikörper (Middle Region)

Produktnummer ABIN630486

Produktdetails anti-RHAG Antikörper

Target: RHAG (Rh Family A Glycoprotein (RHAG))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHAG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHAG antibody was raised against the middle region of RHAG

Aufreinigung: Purified

Immunogen: RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHAG

Target: RHAG (Rh Family A Glycoprotein (RHAG))

Andere Bezeichnung: RHAG (RHAG Produkte)

Synonyme: CD241 antikoerper, RH2 antikoerper, RH50A antikoerper, Rh50 antikoerper, Rh50GP antikoerper, SLC42A1 antikoerper, Rh50A antikoerper, Rh-associated glycoprotein antikoerper, Rh associated glycoprotein antikoerper, Rhesus blood group-associated A glycoprotein antikoerper, RHAG antikoerper, Rhag antikoerper

Hintergrund: The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.

Molekulargewicht: 45 kDa (MW of target protein)