GCNT3 Antikörper
-
- Target Alle GCNT3 Antikörper anzeigen
- GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GCNT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
- Top Product
- Discover our top product GCNT3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GCNT3 Blocking Peptide, catalog no. 33R-1261, is also available for use as a blocking control in assays to test for specificity of this GCNT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))
- Andere Bezeichnung
- GCNT3 (GCNT3 Produkte)
- Synonyme
- C2/4GnT antikoerper, C24GNT antikoerper, C2GNT2 antikoerper, C2GNTM antikoerper, GNTM antikoerper, 2010013H22Rik antikoerper, 2210021I22Rik antikoerper, 2210401J11Rik antikoerper, beta-16-N-acetylglucosaminyltransferase antikoerper, dI/C2/C4GnT antikoerper, c2/4gnt antikoerper, c24gnt antikoerper, c2gnt2 antikoerper, c2gntm antikoerper, gntm antikoerper, glucosaminyl (N-acetyl) transferase 3, mucin type antikoerper, glucosaminyl (N-acetyl) transferase 3, mucin type L homeolog antikoerper, GCNT3 antikoerper, Gcnt3 antikoerper, gcnt3.L antikoerper
- Hintergrund
- This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-