ST6GALNAC5 Antikörper (Middle Region)
-
- Target Alle ST6GALNAC5 Antikörper anzeigen
- ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST6GALNAC5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ST6 GALNAC5 antibody was raised against the middle region of ST6 ALNAC5
- Aufreinigung
- Purified
- Immunogen
- ST6 GALNAC5 antibody was raised using the middle region of ST6 ALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
- Top Product
- Discover our top product ST6GALNAC5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST6GALNAC5 Blocking Peptide, catalog no. 33R-1167, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))
- Andere Bezeichnung
- ST6GALNAC5 (ST6GALNAC5 Produkte)
- Synonyme
- SIAT7E antikoerper, ST6GalNAcV antikoerper, AI851940 antikoerper, Siat7e antikoerper, siat7E antikoerper, st6galnac5 antikoerper, zgc:92262 antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5b antikoerper, ST6GALNAC5 antikoerper, St6galnac5 antikoerper, st6galnac5b antikoerper
- Hintergrund
- ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.
- Molekulargewicht
- 38 kDa (MW of target protein)
-