AADAC Antikörper
-
- Target Alle AADAC Antikörper anzeigen
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AADAC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL
- Top Product
- Discover our top product AADAC Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AADAC Blocking Peptide, catalog no. 33R-6939, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
- Andere Bezeichnung
- AADAC (AADAC Produkte)
- Synonyme
- MGC89272 antikoerper, AADAC antikoerper, CES5A1 antikoerper, DAC antikoerper, Aada antikoerper, 5033417E09Rik antikoerper, AI265437 antikoerper, arylacetamide deacetylase antikoerper, arylacetamide deacetylase S homeolog antikoerper, Arylacetamide deacetylase antikoerper, arylacetamide deacetylase (esterase) antikoerper, LOC100056411 antikoerper, aadac antikoerper, AADAC antikoerper, aadac.S antikoerper, LOC100451808 antikoerper, ACD3 antikoerper, PTRG_10278 antikoerper, aaad antikoerper, Aadac antikoerper
- Hintergrund
- Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.
- Molekulargewicht
- 44 kDa (MW of target protein)
-