PPIB Antikörper
-
- Target Alle PPIB Antikörper anzeigen
- PPIB (Cyclophilin B (PPIB))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPIB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
- Top Product
- Discover our top product PPIB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPIB Blocking Peptide, catalog no. 33R-9877, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIB (Cyclophilin B (PPIB))
- Andere Bezeichnung
- PPIB (PPIB Produkte)
- Synonyme
- cypb antikoerper, scylp antikoerper, cyp-s1 antikoerper, PPIB antikoerper, Ppib antikoerper, ACYPI004891 antikoerper, AA408962 antikoerper, AA553318 antikoerper, AI844835 antikoerper, Cphn-2 antikoerper, Cphn2 antikoerper, CyP-20b antikoerper, CypB antikoerper, Scylp antikoerper, CYP-S1 antikoerper, CYPB antikoerper, OI9 antikoerper, SCYLP antikoerper, cb87 antikoerper, sb:cb87 antikoerper, wu:fa97f08 antikoerper, zgc:73214 antikoerper, zgc:86796 antikoerper, peptidylprolyl isomerase B antikoerper, peptidylprolyl isomerase B (cyclophilin B) antikoerper, peptidylprolyl isomerase B L homeolog antikoerper, ppib antikoerper, PPIB antikoerper, Ppib antikoerper, CC1G_03223 antikoerper, ppib.L antikoerper
- Hintergrund
- PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.
- Molekulargewicht
- 24 kDa (MW of target protein)
-