LTC4S Antikörper (N-Term)

Produktnummer ABIN630425

Produktdetails anti-LTC4S Antikörper

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LTC4S Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LTC4 S antibody was raised against the N terminal of LTC4

Aufreinigung: Purified

Immunogen: LTC4 S antibody was raised using the N terminal of LTC4 corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Anwendungsinformationen

Applikationshinweise: WB: 1-2.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LTC4S

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Andere Bezeichnung: LTC4S (LTC4S Produkte)

Synonyme: LTC4S antikoerper, ltc4s antikoerper, si:dkey-33h4.2 antikoerper, leukotriene C4 synthase antikoerper, leukotriene C4 synthase-like antikoerper, leukotriene C4 synthase, gene 1 antikoerper, Ltc4s antikoerper, LTC4S antikoerper, LTC4SL antikoerper, ltc4s.1 antikoerper, ltc4s antikoerper

Hintergrund: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin