LTC4S Antikörper (N-Term)

Produktnummer ABIN630425

Der Kaninchen Polyklonal anti-LTC4S Antikörper wird verwendet zum Nachweis von LTC4S in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für LTC4S Antikörper (N-Term) (ABIN630425)

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LTC4S Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LTC4S Antikörper

Bindungsspezifität: N-Term

Spezifität: LTC4 S antibody was raised against the N terminal of LTC4

Aufreinigung: Purified

Immunogen: LTC4 S antibody was raised using the N terminal of LTC4 corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Anwendungsinformationen

Applikationshinweise: WB: 1-2.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LTC4S

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Andere Bezeichnung: LTC4S

Hintergrund: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin