TGFBR2 Antikörper

Produktnummer ABIN630421

Produktdetails anti-TGFBR2 Antikörper

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGFBR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: TGFBR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGFBR2 Blocking Peptide, catalog no. 33R-6065, is also available for use as a blocking control in assays to test for specificity of this TGFBR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGFBR2

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Andere Bezeichnung: TGFBR2 (TGFBR2 Produkte)

Synonyme: AAT3 antikoerper, FAA3 antikoerper, LDS1B antikoerper, LDS2B antikoerper, MFS2 antikoerper, RIIC antikoerper, TAAD2 antikoerper, TGFR-2 antikoerper, TGFbeta-RII antikoerper, 1110020H15Rik antikoerper, AU042018 antikoerper, DNIIR antikoerper, RIIDN antikoerper, TBR-II antikoerper, TbetaR-II antikoerper, TbetaRII antikoerper, TGFBR2 antikoerper, TBETA-RII antikoerper, TGFBRII antikoerper, TGF-beta 2 antikoerper, Tgfbr2T antikoerper, cb537 antikoerper, tgfbr2 antikoerper, wu:fj05c10 antikoerper, zgc:110498 antikoerper, transforming growth factor beta receptor 2 antikoerper, transforming growth factor, beta receptor II antikoerper, transforming growth factor, beta receptor 2 antikoerper, transforming growth factor beta receptor 2b antikoerper, TGFBR2 antikoerper, Tgfbr2 antikoerper, tgfbr2b antikoerper

Hintergrund: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Molekulargewicht: 62 kDa (MW of target protein)