PTPN2 Antikörper (N-Term)

Produktnummer ABIN630412

Produktdetails anti-PTPN2 Antikörper

Target: PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPN2 antibody was raised against the N terminal of PTPN2

Aufreinigung: Purified

Immunogen: PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPN2 Blocking Peptide, catalog no. 33R-4905, is also available for use as a blocking control in assays to test for specificity of this PTPN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPN2

Target: PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))

Andere Bezeichnung: PTPN2 (PTPN2 Produkte)

Synonyme: PTN2 antikoerper, PTPT antikoerper, TC-PTP antikoerper, TCELLPTP antikoerper, TCPTP antikoerper, AI325124 antikoerper, Ptpt antikoerper, PTP-1B antikoerper, cb806 antikoerper, ptpn2 antikoerper, ptpn2l antikoerper, wu:fc10h07 antikoerper, zgc:55339 antikoerper, zgc:76973 antikoerper, hm:zeh1546 antikoerper, zgc:63623 antikoerper, ptn2 antikoerper, ptpt antikoerper, tc-ptp antikoerper, tcellptp antikoerper, tcptp antikoerper, protein tyrosine phosphatase, non-receptor type 2 antikoerper, protein tyrosine phosphatase, non-receptor type 2 S homeolog antikoerper, protein tyrosine phosphatase, non-receptor type 2, b antikoerper, protein tyrosine phosphatase, non-receptor type 2, a antikoerper, protein tyrosine phosphatase, non-receptor type 2 L homeolog antikoerper, PTPN2 antikoerper, Ptpn2 antikoerper, ptpn2.S antikoerper, ptpn2b antikoerper, ptpn2a antikoerper, ptpn2.L antikoerper

Hintergrund: PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling