FNDC3B Antikörper (N-Term)

Produktnummer ABIN630408

Produktdetails anti-FNDC3B Antikörper

Target: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FNDC3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FNDC3 B antibody was raised against the N terminal of FNDC3

Aufreinigung: Purified

Immunogen: FNDC3 B antibody was raised using the N terminal of FNDC3 corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FNDC3B Blocking Peptide, catalog no. 33R-7822, is also available for use as a blocking control in assays to test for specificity of this FNDC3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FNDC3B

Target: FNDC3B (Fibronectin Type III Domain Containing 3B (FNDC3B))

Andere Bezeichnung: FNDC3B (FNDC3B Produkte)

Synonyme: FAD104 antikoerper, PRO4979 antikoerper, YVTM2421 antikoerper, 1600019O04Rik antikoerper, AW550168 antikoerper, Fad104 antikoerper, mKIAA4164 antikoerper, RGD1311673 antikoerper, FNDC3B antikoerper, DKFZp469D136 antikoerper, fibronectin type III domain containing 3B antikoerper, FNDC3B antikoerper, Fndc3b antikoerper, fndc3b antikoerper

Hintergrund: FNDC3B may be a positive regulator of adipogenesis.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation