ZDHHC17 Antikörper (Middle Region)

Produktnummer ABIN630405

Produktdetails anti-ZDHHC17 Antikörper

Target: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZDHHC17 antibody was raised against the middle region of ZDHHC17

Aufreinigung: Purified

Immunogen: ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC17 Blocking Peptide, catalog no. 33R-2993, is also available for use as a blocking control in assays to test for specificity of this ZDHHC17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC17

Target: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Andere Bezeichnung: ZDHHC17 (ZDHHC17 Produkte)

Synonyme: A230053P19Rik antikoerper, BB187739 antikoerper, D130071N24Rik antikoerper, Hip14 antikoerper, HIP14 antikoerper, HIP3 antikoerper, HYPH antikoerper, si:ch211-81a6.1 antikoerper, zinc finger DHHC-type containing 17 antikoerper, zinc finger, DHHC domain containing 17 antikoerper, zinc finger, DHHC-type containing 17 antikoerper, ZDHHC17 antikoerper, zdhhc17 antikoerper, Zdhhc17 antikoerper

Hintergrund: ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.

Molekulargewicht: 44 kDa (MW of target protein)