NAT2 Antikörper

Produktnummer ABIN630377

Produktdetails anti-NAT2 Antikörper

Target: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAT2 Blocking Peptide, catalog no. 33R-1747, is also available for use as a blocking control in assays to test for specificity of this NAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAT2

Target: NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))

Andere Bezeichnung: NAT2 (NAT2 Produkte)

Synonyme: AAC2 antikoerper, NAT-2 antikoerper, PNAT antikoerper, AV377607 antikoerper, Nat2a antikoerper, NAT antikoerper, AT-2 antikoerper, AT-B/AT-II antikoerper, AT-II antikoerper, AT2 antikoerper, N-acetyltransferase 2 antikoerper, N-acetyltransferase 2 (arylamine N-acetyltransferase) antikoerper, NAT2 antikoerper, Nat2 antikoerper

Hintergrund: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Molekulargewicht: 32 kDa (MW of target protein)