SLC36A3 Antikörper

Produktnummer ABIN630374

Produktdetails anti-SLC36A3 Antikörper

Target: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC36A3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SLC36 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC36A3 Blocking Peptide, catalog no. 33R-6462, is also available for use as a blocking control in assays to test for specificity of this SLC36A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC36A3

Target: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Andere Bezeichnung: SLC36A3 (SLC36A3 Produkte)

Synonyme: PAT3 antikoerper, TRAMD2 antikoerper, tramdorin2 antikoerper, solute carrier family 36 (proton/amino acid symporter), member 3 antikoerper, solute carrier family 36 member 3 antikoerper, solute carrier family 36, member 3 antikoerper, Slc36a3 antikoerper, SLC36A3 antikoerper

Hintergrund: The function of SLC36A3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 52 kDa (MW of target protein)