SLC7A14 Antikörper
-
- Target Alle SLC7A14 Produkte
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC7A14 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC7 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC7A14 Blocking Peptide, catalog no. 33R-9413, is also available for use as a blocking control in assays to test for specificity of this SLC7A14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
- Andere Bezeichnung
- SLC7A14 (SLC7A14 Produkte)
- Synonyme
- SLC7A14 antikoerper, A930013N06 antikoerper, BC061928 antikoerper, solute carrier family 7 member 14 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 14 antikoerper, solute carrier family 7, member 14 antikoerper, SLC7A14 antikoerper, Slc7a14 antikoerper
- Hintergrund
- SLC7A14 possesses amino acid transmembrane transporter activity.
- Molekulargewicht
- 85 kDa (MW of target protein)
-