SLC5A4 Antikörper
-
- Target Alle SLC5A4 Antikörper anzeigen
- SLC5A4 (Solute Carrier Family 5 (Low Affinity Glucose Cotransporter), Member 4 (SLC5A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC5A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC5 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
- Top Product
- Discover our top product SLC5A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC5A4 Blocking Peptide, catalog no. 33R-5766, is also available for use as a blocking control in assays to test for specificity of this SLC5A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A4 (Solute Carrier Family 5 (Low Affinity Glucose Cotransporter), Member 4 (SLC5A4))
- Andere Bezeichnung
- SLC5A4 (SLC5A4 Produkte)
- Synonyme
- DJ90G24.4 antikoerper, SAAT1 antikoerper, SGLT3 antikoerper, PSGLT2 antikoerper, SLC5A4 antikoerper, Slc5a4a antikoerper, solute carrier family 5 member 4 antikoerper, SLC5A4 antikoerper, Slc5a4 antikoerper
- Hintergrund
- SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Proton Transport
-