ELOVL7 Antikörper

Produktnummer ABIN630361

Produktdetails anti-ELOVL7 Antikörper

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELOVL7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELOVL7 Blocking Peptide, catalog no. 33R-5651, is also available for use as a blocking control in assays to test for specificity of this ELOVL7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELOVL7

Target: ELOVL7 (ELOVL Fatty Acid Elongase 7 (ELOVL7))

Andere Bezeichnung: ELOVL7 (ELOVL7 Produkte)

Synonyme: 9130013K24Rik antikoerper, AI840082 antikoerper, elovl1 antikoerper, wu:fd20a06 antikoerper, zgc:56422 antikoerper, cgpr01 antikoerper, elovl7 antikoerper, fi36f02 antikoerper, wu:fi36f02 antikoerper, zgc:55879 antikoerper, ELOVL fatty acid elongase 7 antikoerper, Elongation of very long chain fatty acids protein 7 antikoerper, elongation of very long chain fatty acids protein 7 antikoerper, ELOVL family member 7, elongation of long chain fatty acids (yeast) antikoerper, ELOVL fatty acid elongase 7b antikoerper, ELOVL fatty acid elongase 7 L homeolog antikoerper, ELOVL fatty acid elongase 7a antikoerper, ELOVL7 antikoerper, elov7 antikoerper, Elovl7 antikoerper, elovl7b antikoerper, elovl7.L antikoerper, elovl7a antikoerper

Hintergrund: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Molekulargewicht: 33 kDa (MW of target protein)