SLC10A5 Antikörper

Produktnummer ABIN630340

Produktdetails anti-SLC10A5 Antikörper

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC10A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC10 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC10A5 Blocking Peptide, catalog no. 33R-3684, is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC10A5

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Andere Bezeichnung: SLC10A5 (SLC10A5 Produkte)

Synonyme: SLC10A5 antikoerper, Gm405 antikoerper, mP5 antikoerper, P5 antikoerper, solute carrier family 10 member 5 antikoerper, solute carrier family 10 (sodium/bile acid cotransporter family), member 5 antikoerper, sodium/bile acid cotransporter 5 antikoerper, solute carrier family 10, member 5 antikoerper, SLC10A5 antikoerper, LOC100456732 antikoerper, Slc10a5 antikoerper

Hintergrund: SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.

Molekulargewicht: 48 kDa (MW of target protein)