SLC26A8 Antikörper (C-Term)
-
- Target Alle SLC26A8 Antikörper anzeigen
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
-
Bindungsspezifität
- C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC26A8 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- SLC26 A8 antibody was raised against the C terminal of SLC26 8
- Aufreinigung
- Purified
- Immunogen
- SLC26 A8 antibody was raised using the C terminal of SLC26 8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
- Top Product
- Discover our top product SLC26A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC26A8 Blocking Peptide, catalog no. 33R-2643, is also available for use as a blocking control in assays to test for specificity of this SLC26A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
- Andere Bezeichnung
- SLC26A8 (SLC26A8 Produkte)
- Synonyme
- SPGF3 antikoerper, TAT1 antikoerper, SLC26A8 antikoerper, MCT10 antikoerper, PRO0813 antikoerper, solute carrier family 26 member 8 antikoerper, solute carrier family 26, member 8 antikoerper, solute carrier family 16 member 10 antikoerper, SLC26A8 antikoerper, Slc26a8 antikoerper, SLC16A10 antikoerper
- Hintergrund
- SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-