SLC22A2 Antikörper

Produktnummer ABIN630308

Produktdetails anti-SLC22A2 Antikörper

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SLC22 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A2 Blocking Peptide, catalog no. 33R-6311, is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A2

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Andere Bezeichnung: SLC22A2 (SLC22A2 Produkte)

Synonyme: OCT2 antikoerper, Oct2 antikoerper, Orct2 antikoerper, OCT2r antikoerper, rOCT2 antikoerper, Pou2f2 antikoerper, OCT2P antikoerper, oct1 antikoerper, wu:fc01b11 antikoerper, zgc:64076 antikoerper, slc22a2 antikoerper, solute carrier family 22 member 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 antikoerper, POU class 2 homeobox 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 L homeolog antikoerper, SLC22A2 antikoerper, Slc22a2 antikoerper, POU2F2 antikoerper, LOC521027 antikoerper, slc22a2 antikoerper, slc22a2.L antikoerper

Hintergrund: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Molekulargewicht: 62 kDa (MW of target protein)