ZP2 Antikörper

Produktnummer ABIN630305

Produktdetails anti-ZP2 Antikörper

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ZP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZP2 Blocking Peptide, catalog no. 33R-7023, is also available for use as a blocking control in assays to test for specificity of this ZP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZP2

Target: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Andere Bezeichnung: ZP2 (ZP2 Produkte)

Synonyme: fa12e07 antikoerper, wu:fa12e07 antikoerper, zgc:152728 antikoerper, zp2 antikoerper, Zp-2 antikoerper, ZPA antikoerper, zona pellucida glycoprotein 2, tandem duplicate 5 antikoerper, zona pellucida glycoprotein 2 antikoerper, zp2.5 antikoerper, Zp2 antikoerper, ZP2 antikoerper

Hintergrund: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.

Molekulargewicht: 68 kDa (MW of target protein)