OR6C70 Antikörper (C-Term)

Produktnummer ABIN630295

Produktdetails anti-OR6C70 Antikörper

Target: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR6C70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR6 C70 antibody was raised against the C terminal of OR6 70

Aufreinigung: Purified

Immunogen: OR6 C70 antibody was raised using the C terminal of OR6 70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR6C70 Blocking Peptide, catalog no. 33R-3552, is also available for use as a blocking control in assays to test for specificity of this OR6C70 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR6C70

Target: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Andere Bezeichnung: OR6C70 (OR6C70 Produkte)

Synonyme: olfactory receptor family 6 subfamily C member 70 antikoerper, OR6C70 antikoerper

Hintergrund: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molekulargewicht: 34 kDa (MW of target protein)