ADIPOQ Antikörper (N-Term)

Produktnummer ABIN630285

Der Kaninchen Polyklonal anti-ADIPOQ Antikörper (ABIN630285) detektiert spezifisch ADIPOQ in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ADIPOQ Antikörper (N-Term) (ABIN630285)

Target: ADIPOQ (Adiponectin (ADIPOQ))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADIPOQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ADIPOQ Antikörper

Bindungsspezifität: N-Term

Spezifität: ACDC antibody was raised against the N terminal Of Acdc

Aufreinigung: Purified

Immunogen: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACDC Blocking Peptide, (ABIN939770), is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADIPOQ

Target: ADIPOQ (Adiponectin (ADIPOQ))

Andere Bezeichnung: ACDC

Hintergrund: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Molekulargewicht: 27 kDa (MW of target protein)