ADIPOQ Antikörper (N-Term)

Produktnummer ABIN630285

Produktdetails anti-ADIPOQ Antikörper

Target: ADIPOQ (Adiponectin (ADIPOQ))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADIPOQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ACDC antibody was raised against the N terminal Of Acdc

Aufreinigung: Purified

Immunogen: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACDC Blocking Peptide, catalog no. 33R-4384, is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADIPOQ

Target: ADIPOQ (Adiponectin (ADIPOQ))

Andere Bezeichnung: ACDC (ADIPOQ Produkte)

Synonyme: ADP antikoerper, DCAF9 antikoerper, 6720489L24Rik antikoerper, 9330209L04Rik antikoerper, Adp antikoerper, Mamdc1 antikoerper, RNSVSP4U antikoerper, SVSIV1 antikoerper, Svp4 antikoerper, ACDC antikoerper, ACRP30 antikoerper, ADIPQTL1 antikoerper, ADPN antikoerper, APM-1 antikoerper, APM1 antikoerper, GBP28 antikoerper, apM-1 antikoerper, 30kDa antikoerper, APN antikoerper, Acdc antikoerper, Acrp30 antikoerper, Ad antikoerper, adipo antikoerper, apM1 antikoerper, ADN antikoerper, acrpl antikoerper, adipo-b antikoerper, adipoql antikoerper, zgc:153584 antikoerper, adipoq antikoerper, WD and tetratricopeptide repeats 1 antikoerper, MAM domain containing glycosylphosphatidylinositol anchor 2 antikoerper, seminal vesicle secretory protein 4 antikoerper, adiponectin, C1Q and collagen domain containing antikoerper, adiponectin, C1Q and collagen domain containing, b antikoerper, adiponectin, C1Q and collagen domain containing L homeolog antikoerper, WDTC1 antikoerper, Mdga2 antikoerper, Svs4 antikoerper, ADIPOQ antikoerper, Adipoq antikoerper, adipoqb antikoerper, adipoq.L antikoerper

Hintergrund: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Molekulargewicht: 27 kDa (MW of target protein)