NELL2 Antikörper

Produktnummer ABIN630282

Produktdetails anti-NELL2 Antikörper

Target: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NELL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NELL2 Blocking Peptide, catalog no. 33R-5966, is also available for use as a blocking control in assays to test for specificity of this NELL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NELL2

Target: NELL2 (NEL-Like 2 (Chicken) (NELL2))

Andere Bezeichnung: NELL2 (NELL2 Produkte)

Synonyme: A330108N19Rik antikoerper, R75516 antikoerper, mel91 antikoerper, nel antikoerper, NRP2 antikoerper, nell2 antikoerper, wu:fj43h11 antikoerper, zgc:158375 antikoerper, neural EGFL like 2 L homeolog antikoerper, NEL-like 2 antikoerper, neural EGFL like 2 antikoerper, neural EGFL like 2a antikoerper, nell2.L antikoerper, Nell2 antikoerper, NELL2 antikoerper, nell2a antikoerper

Hintergrund: NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.

Molekulargewicht: 91 kDa (MW of target protein)