C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) Antikörper

Produktnummer ABIN630277

Produktdetails

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CLEC4 M antibody was raised against the N terminal of CLEC4

Aufreinigung: Purified

Immunogen: CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLEC4M Blocking Peptide, catalog no. 33R-5525, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Andere Bezeichnung: CLEC4M (CLEC4M Produkte)

Synonyme: CD209L antikoerper, CD299 antikoerper, DC-SIGN2 antikoerper, DC-SIGNR antikoerper, DCSIGNR antikoerper, HP10347 antikoerper, L-SIGN antikoerper, LSIGN antikoerper, CD209B antikoerper, C-type lectin domain family 4 member M antikoerper, CLEC4M antikoerper

Hintergrund: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.

Molekulargewicht: 44 kDa (MW of target protein)