NEDD9 Antikörper (Middle Region)

Produktnummer ABIN630274

Produktdetails anti-NEDD9 Antikörper

Target: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NEDD9 antibody was raised against the middle region of NEDD9

Aufreinigung: Purified

Immunogen: NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEDD9 Blocking Peptide, catalog no. 33R-3816, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEDD9

Target: NEDD9 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9))

Andere Bezeichnung: NEDD9 (NEDD9 Produkte)

Synonyme: NEDD9 antikoerper, CAS-L antikoerper, CAS2 antikoerper, CASL antikoerper, CASS2 antikoerper, HEF1 antikoerper, Cas-L antikoerper, CasL antikoerper, E230025G09Rik antikoerper, neural precursor cell expressed, developmentally down-regulated 9 antikoerper, neural precursor cell expressed, developmentally down-regulated gene 9 antikoerper, NEDD9 antikoerper, Nedd9 antikoerper

Hintergrund: Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

Molekulargewicht: 93 kDa (MW of target protein)