Annexin A13 Antikörper (N-Term)
-
- Target Alle Annexin A13 (ANXA13) Antikörper anzeigen
- Annexin A13 (ANXA13)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin A13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A13 antibody was raised against the N terminal of ANXA13
- Kreuzreaktivität
- Human
- Aufreinigung
- Purified
- Immunogen
- Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE
- Top Product
- Discover our top product ANXA13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A13 Blocking Peptide, catalog no. 33R-2628, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin A13 (ANXA13)
- Andere Bezeichnung
- Annexin A13 (ANXA13 Produkte)
- Synonyme
- ANX13 antikoerper, ISA antikoerper, anxa6 antikoerper, MGC82170 antikoerper, 1810034H17Rik antikoerper, AV055219 antikoerper, anx13 antikoerper, wu:fb40a08 antikoerper, ANXA13 antikoerper, MGC108373 antikoerper, annexin A13 antikoerper, annexin A13 L homeolog antikoerper, ANXA13 antikoerper, anxa13.L antikoerper, Anxa13 antikoerper, anxa13 antikoerper, PAAG_01138 antikoerper
- Substanzklasse
- Chemical
- Hintergrund
- ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.
- Molekulargewicht
- 39 kDa (MW of target protein)
-