PHAP1 Antikörper
-
- Target Alle PHAP1 (ANP32A) Antikörper anzeigen
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- ANP32 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI
- Top Product
- Discover our top product ANP32A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANP32A Blocking Peptide, catalog no. 33R-5937, is also available for use as a blocking control in assays to test for specificity of this ANP32A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
- Andere Bezeichnung
- ANP32A (ANP32A Produkte)
- Synonyme
- C15orf1 antikoerper, HPPCn antikoerper, I1PP2A antikoerper, LANP antikoerper, MAPM antikoerper, PHAP1 antikoerper, PHAPI antikoerper, PP32 antikoerper, Anp32 antikoerper, W91701 antikoerper, pp32 antikoerper, Anp32a antikoerper, CG5784 antikoerper, CT18148 antikoerper, CT42180 antikoerper, Dmel\\CG5784 antikoerper, anon-EST:fe3A2 antikoerper, wu:fj36e08 antikoerper, zgc:55516 antikoerper, ANP32D antikoerper, acidic nuclear phosphoprotein 32 family member A antikoerper, acidic (leucine-rich) nuclear phosphoprotein 32 family, member A antikoerper, CG5784 gene product from transcript CG5784-RB antikoerper, acidic nuclear phosphoprotein 32 family member A L homeolog antikoerper, ANP32A antikoerper, Anp32a antikoerper, Mapmodulin antikoerper, anp32a antikoerper, anp32a.L antikoerper
- Hintergrund
- ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
- Molekulargewicht
- 29 kDa (MW of target protein)
-