IGLL1 Antikörper (N-Term)

Produktnummer ABIN630214

Produktdetails anti-IGLL1 Antikörper

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IGLL1 antibody was raised against the N terminal of IGLL1

Aufreinigung: Purified

Immunogen: IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGLL1 Blocking Peptide, catalog no. 33R-8211, is also available for use as a blocking control in assays to test for specificity of this IGLL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGLL1

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Andere Bezeichnung: IGLL1 (IGLL1 Produkte)

Synonyme: 14.1 antikoerper, AGM2 antikoerper, CD179b antikoerper, IGL1 antikoerper, IGL5 antikoerper, IGLJ14.1 antikoerper, IGLL antikoerper, IGO antikoerper, IGVPB antikoerper, VPREB2 antikoerper, IGLV antikoerper, IGLL1 antikoerper, MGC151892 antikoerper, Igll1 antikoerper, BB139905 antikoerper, Igl-5 antikoerper, Igll antikoerper, Lambda5 antikoerper, immunoglobulin lambda like polypeptide 1 antikoerper, immunoglobulin lambda-like polypeptide 1 antikoerper, IGLL1 antikoerper, Igll1 antikoerper

Hintergrund: The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin geneuperfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size